Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ynzK (ynzK)

This Recombinant Uncharacterized membrane protein ynzK (ynzK) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ynzK

UniProt

C0H417

Expression Region

1-118

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRNIVFYLILLCLFISVVMKSFEVIRTIANVICFIFVLLYFKDEMKTYSRKALAILSIC FLFLVGICAFIILQGQTLMKRHLFFTGLETIAGILLIIVSLSICTFILRKISNRLKRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal OGG1 Antibody (2B4) - Azide and BSA Free
NBP2-80891 0.1 mg

Mouse Monoclonal OGG1 Antibody (2B4) - Azide and BSA Free

Sign In for Pricing
View Details
P-Cresyl sulfate
HY-111431-01 5 mg

P-Cresyl sulfate

Sign In for Pricing
View Details
P-Cresyl sulfate
HY-111431-02 10 mM - 1 mL

P-Cresyl sulfate

Sign In for Pricing
View Details
P-Cresyl sulfate
HY-111431-03 10 mg

P-Cresyl sulfate

Sign In for Pricing
View Details
Rat Hyaluronan mediated motility Receptor, HMMR GENLISA ELISA
KLR0962 96 Well

Rat Hyaluronan mediated motility Receptor, HMMR GENLISA ELISA

Sign In for Pricing
View Details
CBWD1 Human shRNA Plasmid Kit (Locus ID 55871)
TL305622 1 Kit

CBWD1 Human shRNA Plasmid Kit (Locus ID 55871)

Sign In for Pricing
View Details