Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Desulfitobacterium hafniense Protein CrcB homolog 2 (crcB2)

This Recombinant Desulfitobacterium hafniense Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q24VQ5

Expression Region

1-118

Origin

Desulfitobacterium hafniense (strain Y51)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASHILLVGIGGFCGAIVRYFFSRKLNSGKLPVGTLTVNLSGAFLLGAMAGANLSTTTTL LLGTGFLGAFTTFSTLKLEMAQLQLKKEHRLFILYTTITYGGGIALAYLGYWLGSFFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-100 1x 100 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details