Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0759 (MJ0759)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0759 (MJ0759) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0759

UniProt

Q58169

Expression Region

1-118

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIKKGEIMNEIISLVSLSVIFGAMLSGFATFRLTGMRLMPHFASLMIAFILTLASLFIS NNIIGYLAIAFQVITPLTVCPTICNILKTQFQNTGIYSAHLALMGMMFILALGNVILF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR-4 Monoclonal Antibody
JOT-MCA0535-01 20 µL

FGFR-4 Monoclonal Antibody

Sign In for Pricing
View Details
FGFR-4 Monoclonal Antibody
JOT-MCA0535-02 50 μL

FGFR-4 Monoclonal Antibody

Sign In for Pricing
View Details
FGFR-4 Monoclonal Antibody
JOT-MCA0535-03 100 µL

FGFR-4 Monoclonal Antibody

Sign In for Pricing
View Details
MBD1 Polyclonal Antibody, APC Conjugated
bs-5915R-APC 100 µL

MBD1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Pcgf5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
36193114 3x 1.0 µg

Pcgf5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Vstm4 (NM_178791) Mouse Tagged ORF Clone
MG213699 10 µg

Vstm4 (NM_178791) Mouse Tagged ORF Clone

Sign In for Pricing
View Details