Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian Protein CrcB homolog 2 (crcB2)

This Recombinant Bacillus thuringiensis subsp. konkukian Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q6HBI2

Expression Region

1-118

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEALLVATGGFFGAITRFAISNWLKKRNKTQFPIATFLINITGAFLLGYIIGSGVTTGW QLLLGTGFMGAFTTFSTFKLESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMKLGGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-500 1x 500 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), Biotin conjugate, 0.1mg/mL
BNCB0175-500 1x 500 µL

CD46 (122.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details