Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Superoxide-generating NADPH oxidase light chain subunit (cybA)

This Recombinant Dictyostelium discoideum Superoxide-generating NADPH oxidase light chain subunit (cybA) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Superoxide-generating NADPH oxidase light chain subunit, Cytochrome b-245 light chain, p22-phox, p22phox

UniProt

Q867X6

Expression Region

1-118

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKFKLGNWAAMIGMAACWCLIAGGIMGIWYERRYIAIYSICVGGVLYPLLYPLSFLGPL KAIFHQYYVAAALMAGLSVLCYFLVPTMLAAMVMDISAVVFLISAIKGERGDFFDKQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EGR3 Protein, N-His
E55P2227 50 µg

Recombinant Human EGR3 Protein, N-His

Sign In for Pricing
View Details
Chicken Carboxypeptidase B2 (CPB2) ELISA Kit
MBS9924046 Inquire

Chicken Carboxypeptidase B2 (CPB2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Interleukin 1 receptor accessory protein (IL1RAP), partial (Active)
orb2280211-01 20 µg

Recombinant Macaca fascicularis Interleukin 1 receptor accessory protein (IL1RAP), partial (Active)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Interleukin 1 receptor accessory protein (IL1RAP), partial (Active)
orb2280211-02 100 µg

Recombinant Macaca fascicularis Interleukin 1 receptor accessory protein (IL1RAP), partial (Active)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Interleukin 1 receptor accessory protein (IL1RAP), partial (Active)
orb2280211-03 1 mg

Recombinant Macaca fascicularis Interleukin 1 receptor accessory protein (IL1RAP), partial (Active)

Sign In for Pricing
View Details
MK 761 hydrochloride
orb1740462-01 25 mg

MK 761 hydrochloride

Sign In for Pricing
View Details