Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Protein CrcB homolog 2 (crcB2)

This Recombinant Bacillus cereus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q815R5

Expression Region

1-118

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEALLVATGGFFGAITRFAISNWFKKRNKTQFPLATFLINITGAFLLGYIIGNGVTTGW QLLLGTGFMGAFTTFSTFKLEAVQLLNRKNISTFLLYLSATYIIGILFAFLGMKLGGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL
BNC470902-500 1x 500 µL

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF568 conjugate, 0.1mg/mL
BNC682746-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF594 conjugate, 0.1mg/mL
BNC940183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF594 conjugate, 0.1mg/mL
BNC940700-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details