Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yijD (yijD)

This Recombinant Inner membrane protein yijD (yijD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Inner membrane protein yijD

UniProt

P0AF41

Expression Region

1-119

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMP VGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQEVAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA4 Rabbit Polyclonal Antibody
AP06693PU-N 100 µg

GATA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NANOG Human Gene Knockout Kit (CRISPR)
KN210243 1 Kit

NANOG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Formylbenzoic Acid
TRC-F697400-10G 10 g

4-Formylbenzoic Acid

Sign In for Pricing
View Details
Recombinant Intestinal Alkaline Phosphatase Antibody
RC-15753-01 50 μL

Recombinant Intestinal Alkaline Phosphatase Antibody

Sign In for Pricing
View Details
Recombinant Intestinal Alkaline Phosphatase Antibody
RC-15753-02 100 µL

Recombinant Intestinal Alkaline Phosphatase Antibody

Sign In for Pricing
View Details
Recombinant Intestinal Alkaline Phosphatase Antibody
RC-15753-03 1 mL

Recombinant Intestinal Alkaline Phosphatase Antibody

Sign In for Pricing
View Details