Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yijD (yijD)

This Recombinant Inner membrane protein yijD (yijD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Inner membrane protein yijD

UniProt

P0AF42

Expression Region

1-119

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMP VGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQEVAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-Phenoxyethyl) butan-1-amine
OR1047366-01 100 mg

N- (2-Phenoxyethyl) butan-1-amine

Sign In for Pricing
View Details
N- (2-Phenoxyethyl) butan-1-amine
OR1047366-02 250 mg

N- (2-Phenoxyethyl) butan-1-amine

Sign In for Pricing
View Details
N- (2-Phenoxyethyl) butan-1-amine
OR1047366-03 1 g

N- (2-Phenoxyethyl) butan-1-amine

Sign In for Pricing
View Details
KHSRP (Far Upstream Element-binding Protein 2, FUSE-binding Protein 2, KH Type-splicing Regulatory Protein, KSRP, p75, FUBP2, MGC99676) APC
MBS6137286-01 0.1 mL

KHSRP (Far Upstream Element-binding Protein 2, FUSE-binding Protein 2, KH Type-splicing Regulatory Protein, KSRP, p75, FUBP2, MGC99676) APC

Sign In for Pricing
View Details
KHSRP (Far Upstream Element-binding Protein 2, FUSE-binding Protein 2, KH Type-splicing Regulatory Protein, KSRP, p75, FUBP2, MGC99676) APC
MBS6137286-02 5x 0.1 mL

KHSRP (Far Upstream Element-binding Protein 2, FUSE-binding Protein 2, KH Type-splicing Regulatory Protein, KSRP, p75, FUBP2, MGC99676) APC

Sign In for Pricing
View Details
FBS-Fetal Bovine Serum
MBS555797-01 500 mL

FBS-Fetal Bovine Serum

Sign In for Pricing
View Details