Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Spermidine export protein MdtJ (mdtJ)

This Recombinant Cronobacter sakazakii Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

A7MEJ4

Expression Region

1-119

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYWILLALAIVSEITGTLALKWASVGGGHAGFILMLVMISLSYILLSFSVKRIALGVAY ALWEGVGIVLITLFSVLLFNETLTVQKALGLLVLIAGILLIKTGTRTVSRKAEVRHVAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS801411 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse Alkaline Phosphatase, Liver/Bone/Kidney (ALPL) ELISA Kit
RD-ALPL-Mu-01 96 Tests

Mouse Alkaline Phosphatase, Liver/Bone/Kidney (ALPL) ELISA Kit

Sign In for Pricing
View Details
Mouse Alkaline Phosphatase, Liver/Bone/Kidney (ALPL) ELISA Kit
RD-ALPL-Mu-02 48 Tests

Mouse Alkaline Phosphatase, Liver/Bone/Kidney (ALPL) ELISA Kit

Sign In for Pricing
View Details
Human CDCA3 activation kit by CRISPRa
GA113178 1 Kit

Human CDCA3 activation kit by CRISPRa

Sign In for Pricing
View Details
RNF113B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]
TA504121BM 100 µL

RNF113B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]

Sign In for Pricing
View Details
BET1 Rabbit Polyclonal Antibody
TA362174 100 µL

BET1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details