Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Multidrug resistance protein EbrB (ebrB)

This Recombinant Bacillus licheniformis Multidrug resistance protein EbrB (ebrB) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrB

UniProt

Q65JB2

Expression Region

1-119

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGMIFLAAAILSEVFGSTMLKLSEGFSAPLPAAGVIIGFAASFTFLSFSLKTLPLSAAY ATWAGTGTALTAAIGHFIFQEPFNLKTLIGLTLIIGGVFLLNSKRTEAADQKAQLTIEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K13 Antibody
orb1313046-01 30 µL

MAP3K13 Antibody

Sign In for Pricing
View Details
MAP3K13 Antibody
orb1313046-02 50 μL

MAP3K13 Antibody

Sign In for Pricing
View Details
MAP3K13 Antibody
orb1313046-03 100 µL

MAP3K13 Antibody

Sign In for Pricing
View Details
AGA Rabbit Polyclonal Antibody
orb77797 100 µg

AGA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Ribosome-binding factor A (rbfA)
MBS1058985-01 0.02 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides Ribosome-binding factor A (rbfA)

Sign In for Pricing
View Details
Recombinant Chlorobium phaeobacteroides Ribosome-binding factor A (rbfA)
MBS1058985-02 0.1 mg (E-Coli)

Recombinant Chlorobium phaeobacteroides Ribosome-binding factor A (rbfA)

Sign In for Pricing
View Details