Recombinant Citrobacter koseri Spermidine export protein MdtJ (mdtJ)
This Recombinant Citrobacter koseri Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-120.
Product Specifications
Product Name Alternative
Spermidine export protein MdtJ
UniProt
A8AGX5
Expression Region
1-120
Origin
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFYWILLALAIAAEITGTLSMKWASVSNGNTGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITLFSVLLFDEALSAMKIAGLVTLVFGIALIKSGTRKPVNAAKEATHAAV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
254131 50 µL
KPNA2 (KPNA2, IMA2_HUMAN, Importin alpha 1, Importin alpha 2, Importin alpha 2 Subunit, Importin alpha P1, Importin Subunit alpha-2, IPOA1, IPOA 1, IPOA1, Karyopherin alpha 2, Karyopherin alpha 2 RAG cohort 1, Karyopherin alpha 2 Subunit, Karyopherin Subunit alpha-2, KPNA2, KPNA2Protein, Pendulin, QIP 2, QIP2, RAG cohort 1, RAG cohort Protein 1, RCH 1, RCH1, SRP 1, SRP1 alpha, SRP1, SRP1-alpha, SRP1alpha)
Sign In for Pricing
View Details