Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Spermidine export protein MdtJ (mdtJ)

This Recombinant Citrobacter koseri Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

A8AGX5

Expression Region

1-120

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFYWILLALAIAAEITGTLSMKWASVSNGNTGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITLFSVLLFDEALSAMKIAGLVTLVFGIALIKSGTRKPVNAAKEATHAAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gly-7-MAD-MDCPT hydrochloride
T210922-01 10 mg

Gly-7-MAD-MDCPT hydrochloride

Sign In for Pricing
View Details
Gly-7-MAD-MDCPT hydrochloride
T210922-02 50 mg

Gly-7-MAD-MDCPT hydrochloride

Sign In for Pricing
View Details
Rabbit Polyclonal DPPA4 Antibody [Janelia Fluor 549]
NBP2-99578JF549 0.1 mL

Rabbit Polyclonal DPPA4 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Anti-TRAP220/MED1  (2G1)
YF-MA14827 100 ug

Anti-TRAP220/MED1 (2G1)

Sign In for Pricing
View Details
Vancomycin CDP-1 discontinued
022721-01 5 mg

Vancomycin CDP-1 discontinued

Sign In for Pricing
View Details
Vancomycin CDP-1 discontinued
022721-02 10 mg

Vancomycin CDP-1 discontinued

Sign In for Pricing
View Details