Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q8XEK5

Expression Region

1-120

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CtIP shRNA (m) Lentiviral Particles
sc-37766-V 200 µL

CtIP shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 405)
MBS6191056-01 0.1 mL

MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 405)

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 405)
MBS6191056-02 5x 0.1 mL

MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 405)

Sign In for Pricing
View Details
Human Death-inducer obliterator 1 ELISA Kit
EK5062 Inquire

Human Death-inducer obliterator 1 ELISA Kit

Sign In for Pricing
View Details
Paraffin Tissue Section - Human Adult Normal: Placenta
T2234200 5 Slides

Paraffin Tissue Section - Human Adult Normal: Placenta

Sign In for Pricing
View Details
Human Squamous Cell Carcinoma Antigen 1 (SCCA1) ELISA Kit
RDR-SCCA1-Hu-96Tests 96 Tests

Human Squamous Cell Carcinoma Antigen 1 (SCCA1) ELISA Kit

Sign In for Pricing
View Details