Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q8XEK5

Expression Region

1-120

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHCBP1 Antibody; HRP conjugated
MBS7003912-01 0.05 mg

SHCBP1 Antibody; HRP conjugated

Sign In for Pricing
View Details
SHCBP1 Antibody; HRP conjugated
MBS7003912-02 0.1 mg

SHCBP1 Antibody; HRP conjugated

Sign In for Pricing
View Details
SHCBP1 Antibody; HRP conjugated
MBS7003912-03 5x 0.1 mg

SHCBP1 Antibody; HRP conjugated

Sign In for Pricing
View Details
RNASET2 Recombinant Protein
OPCD06726-50UG 50 µg

RNASET2 Recombinant Protein

Sign In for Pricing
View Details
FOXO3 Mouse Monoclonal Antibody [Clone ID: LBI3E6]
AMM19017VCF 100 µg

FOXO3 Mouse Monoclonal Antibody [Clone ID: LBI3E6]

Sign In for Pricing
View Details
TOMM34 Mouse Monoclonal Antibody [Clone ID: OTI 2E11]
CF503077 100 µg

TOMM34 Mouse Monoclonal Antibody [Clone ID: OTI 2E11]

Sign In for Pricing
View Details