Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella phage SfX Bactoprenol-linked glucose translocase (gtrA)

This Recombinant Shigella phage SfX Bactoprenol-linked glucose translocase (gtrA) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Bactoprenol-linked glucose translocase

UniProt

Q9T1D7

Expression Region

1-120

Origin

Shigella phage SfX (Shigella flexneri bacteriophage X) (Bacteriophage SfX)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKLFAKYTSIGVLNTLIHWVVFGVCIYAAHTNQAMANFAGFVVAVSFSFFANAKFTFKA STTTMRYMLYVGFMGTLSATVGWVADRCSLPPIVTLVTFSAISLVCGFVYSKFIVFRDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL
BNC680779-100 1x 100 µL

CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL
BNC042197-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL
BNC941688-100 1x 100 µL

CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details