Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naegleria fowleri ATP synthase subunit a (ATP6)

This Recombinant Naegleria fowleri ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P22067

Expression Region

1-120

Origin

Naegleria fowleri (Brain eating amoeba)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFFYSLFKGTYNFIYVTIYSYLVDRTKMFFPFFFYLFLFICLSNLVGIVPFSFTITSHLN ITFSLSFLVWWATCLLGFYESGLAFIAIFYVKGIPFVLVPFWALIEVISFIFRSVGLSLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog