Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

A1ABE5

Expression Region

1-121

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 7 (IL-7) (APC) discontinued
I8429-25A-APC 100 µL

Interleukin 7 (IL-7) (APC) discontinued

Sign In for Pricing
View Details
TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (Azide free) (HRP) discontinued
043067-HRP 200 µL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol
OR1090021-01 250 mg

1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details
1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol
OR1090021-02 500 mg

1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details
1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol
OR1090021-03 1 g

1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details
1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol
OR1090021-04 5 g

1- (6-bromo-2,3-dichlorophenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details