Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

A1ABE5

Expression Region

1-121

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM20 Rabbit Polyclonal Antibody (BF405)
orb1578945 100 µL

RBM20 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM3C Antibody [Alexa Fluor 405]
NBP2-24464AF405 0.1 mL

Rabbit Polyclonal FAM3C Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse Monoclonal Brucella Abortus Antibody (BrG11) [DyLight 350]
NB100-73111UV 0.2 mL

Mouse Monoclonal Brucella Abortus Antibody (BrG11) [DyLight 350]

Sign In for Pricing
View Details
DAG1 (Dystroglycan, Dystroglycan 1)
479007 100 µL

DAG1 (Dystroglycan, Dystroglycan 1)

Sign In for Pricing
View Details
Globotriose
sc-257557 500 µg

Globotriose

Sign In for Pricing
View Details
RHBG Peptide - N-terminal region (AAP49502)
AAP49502-100UG 100 µg

RHBG Peptide - N-terminal region (AAP49502)

Sign In for Pricing
View Details