Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

A1ABE5

Expression Region

1-121

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd40 (NM_011611) Mouse Tagged ORF Clone Lentiviral Particle
MR227111L3V 200 µL

Cd40 (NM_011611) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(2E) -6-[[ (1,1-Dimethylethoxy) carbonyl]amino]-2-hexenoic Acid Ethyl Ester
421596-01 50 mg

(2E) -6-[[ (1,1-Dimethylethoxy) carbonyl]amino]-2-hexenoic Acid Ethyl Ester

Sign In for Pricing
View Details
(2E) -6-[[ (1,1-Dimethylethoxy) carbonyl]amino]-2-hexenoic Acid Ethyl Ester
421596-02 250 mg

(2E) -6-[[ (1,1-Dimethylethoxy) carbonyl]amino]-2-hexenoic Acid Ethyl Ester

Sign In for Pricing
View Details
Hsa-miR-6813-3p agomir
HY-R02190A-01 5 nmol

Hsa-miR-6813-3p agomir

Sign In for Pricing
View Details
Hsa-miR-6813-3p agomir
HY-R02190A-02 20 nmol

Hsa-miR-6813-3p agomir

Sign In for Pricing
View Details
Rabbit Polyclonal ANKHD1 Antibody [DyLight 680]
NBP1-78211FR 0.1 mL

Rabbit Polyclonal ANKHD1 Antibody [DyLight 680]

Sign In for Pricing
View Details