Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0344 protein BCAH820_1232 (BCAH820_1232)

This Recombinant Bacillus cereus UPF0344 protein BCAH820_1232 (BCAH820_1232) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

UPF0344 protein BCAH820_1232

UniProt

B7JDV6

Expression Region

1-121

Origin

Bacillus cereus (strain AH820)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF488A conjugate, 0.1mg/mL
BNC880838-500 1x 500 µL

MAGE A1 (MZ2E/838), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 4 (KRT4) (KRT4/2804), CF640R conjugate, 0.1mg/mL
BNC402804-100 1x 100 µL

Cytokeratin 4 (KRT4) (KRT4/2804), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL
BNC470733-100 1x 100 µL

TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details