Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

This Recombinant Bacillus cereus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

B9IUJ0

Expression Region

1-121

Origin

Bacillus cereus (strain Q1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF594 conjugate, 0.1mg/mL
BNC942268-100 1x 100 µL

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79A Mouse Monoclonal Antibody [Clone ID: HM47/A9]
AM00232PU-S 100 µg

CD79A Mouse Monoclonal Antibody [Clone ID: HM47/A9]

Sign In for Pricing
View Details
AMACR Mouse Monoclonal Antibody [Clone ID: OTI6C7]
CF808493 100 µg

AMACR Mouse Monoclonal Antibody [Clone ID: OTI6C7]

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2492), CF488A conjugate, 0.1mg/mL
BNC882492-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2492), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F2]
TA504245BM 100 µL

C1S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F2]

Sign In for Pricing
View Details
L-Alanyl-L-1-aminoethylphosphonic Acid
TRC-A511353-50MG 50 mg

L-Alanyl-L-1-aminoethylphosphonic Acid

Sign In for Pricing
View Details