Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237)

This Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

UPF0344 protein BAA_1237

UniProt

C3P3K4

Expression Region

1-121

Origin

Bacillus anthracis (strain A0248)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque DUSP21 Protein, His (Fc)-Avi-tagged
DUSP21-1177R 50 µg

Recombinant Rhesus Macaque DUSP21 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rat Pak1 ELISA Kit
ELI-22009r 96 Tests

Rat Pak1 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Spastin Antibody (2F5)
H00006683-M02 0.1 mg

Mouse Monoclonal Spastin Antibody (2F5)

Sign In for Pricing
View Details
CD151 Peptide
DF6699-BP 1 mg

CD151 Peptide

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Dickkopf Related Protein 2 (DKK2)
MBS2108291-01 0.1 mL

APC-Linked Monoclonal Antibody to Dickkopf Related Protein 2 (DKK2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Dickkopf Related Protein 2 (DKK2)
MBS2108291-02 0.2 mL

APC-Linked Monoclonal Antibody to Dickkopf Related Protein 2 (DKK2)

Sign In for Pricing
View Details