Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237)

This Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

UPF0344 protein BAA_1237

UniProt

C3P3K4

Expression Region

1-121

Origin

Bacillus anthracis (strain A0248)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC Antibody
CSB-PA017511LA01HU-01 50 µg

PC Antibody

Sign In for Pricing
View Details
PC Antibody
CSB-PA017511LA01HU-02 100 µg

PC Antibody

Sign In for Pricing
View Details
FRAT1, CT (FRAT1, Proto-oncogene FRAT1, Frequently rearranged in advanced T-cell lymphomas 1) (MaxLight 550) discontinued
035763-ML550 100 µL

FRAT1, CT (FRAT1, Proto-oncogene FRAT1, Frequently rearranged in advanced T-cell lymphomas 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
BMAL1 (ARNTL) (NM_001030273) Human Tagged ORF Clone Lentiviral Particle
RC204464L3V 200 µL

BMAL1 (ARNTL) (NM_001030273) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ADAR2 (A-3)
sc-393068 200 µg/mL

ADAR2 (A-3)

Sign In for Pricing
View Details
Recombinant Mycoplasma Pulmonis (Mp) protein control for Western Blot
MPUL11-C 100 µL

Recombinant Mycoplasma Pulmonis (Mp) protein control for Western Blot

Sign In for Pricing
View Details