Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237)

This Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

UPF0344 protein BAA_1237

UniProt

C3P3K4

Expression Region

1-121

Origin

Bacillus anthracis (strain A0248)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl9 Mouse shRNA Plasmid (Locus ID 242521)
TL507369 1 Kit

Klhl9 Mouse shRNA Plasmid (Locus ID 242521)

Sign In for Pricing
View Details
1-Bromo-2- (bromomethyl) -3-chlorobenzene
ADA00298-01 5 g

1-Bromo-2- (bromomethyl) -3-chlorobenzene

Sign In for Pricing
View Details
1-Bromo-2- (bromomethyl) -3-chlorobenzene
ADA00298-02 50 g

1-Bromo-2- (bromomethyl) -3-chlorobenzene

Sign In for Pricing
View Details
Cadherin-17 monoclonal antibody (4F6H5)
ENZ-ABS979-0100 100 µL

Cadherin-17 monoclonal antibody (4F6H5)

Sign In for Pricing
View Details
C10ORF126 ORF Vector (Human) (pORF)
ORF001122 1.0 µg DNA

C10ORF126 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
AMHR2 Recombinant Protein (Mouse)
RP115586 100 µg

AMHR2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details