Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

This Recombinant Bacillus cereus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

C1ENB1

Expression Region

1-121

Origin

Bacillus cereus (strain 03BB102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCYL1 siRNA (m)
sc-153277 10 µM

SCYL1 siRNA (m)

Sign In for Pricing
View Details
Glut6 CRISPR Activation Plasmid (h2)
sc-406852-ACT-2 20 µg

Glut6 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
DPH6 Peptide - middle region (AAP79538)
AAP79538-100UG 100 µg

DPH6 Peptide - middle region (AAP79538)

Sign In for Pricing
View Details
HSPE1/HSP10/CPN10 Rabbit pAb
E45R27389N-50 50 µL

HSPE1/HSP10/CPN10 Rabbit pAb

Sign In for Pricing
View Details
Nphp1 3'UTR Lenti-reporter-Luc Vector
32056086 1.0 µg

Nphp1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mitochondrial Fission 1 Protein Rabbit mAb
MBS4763292-01 0.1 mL

Mitochondrial Fission 1 Protein Rabbit mAb

Sign In for Pricing
View Details