Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q2YTK5

Expression Region

1-121

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLVANLTGAFIMGLLTALTIAFFSNHPT LKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAITSYVFGILLCYVGIKLGGGL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS515776 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Human COL3 (Collagen Type III) ELISA Kit
E-EL-H6049-01 24 Tests

Human COL3 (Collagen Type III) ELISA Kit

Sign In for Pricing
View Details
Human COL3 (Collagen Type III) ELISA Kit
E-EL-H6049-02 48 Tests

Human COL3 (Collagen Type III) ELISA Kit

Sign In for Pricing
View Details
Human COL3 (Collagen Type III) ELISA Kit
E-EL-H6049-03 96 Tests

Human COL3 (Collagen Type III) ELISA Kit

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Human Gene Knockout Kit (CRISPR)
KN208947LP 1 Kit

beta Catenin (CTNNB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caspase-3 Antibody
F48960-0.08ML 0.08 mL

Caspase-3 Antibody

Sign In for Pricing
View Details