Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q2YTK5

Expression Region

1-121

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLVANLTGAFIMGLLTALTIAFFSNHPT LKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAITSYVFGILLCYVGIKLGGGL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Secretory Component / ECM1 (ECM1/2889R), CF568 conjugate, 0.1mg/mL
BNC682889-500 1x 500 µL

Secretory Component / ECM1 (ECM1/2889R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(4-Hydroxyphenoxy-2,3,5,6-d4)-propanoic Acid
TRC-H972927-5MG 5 mg

2-(4-Hydroxyphenoxy-2,3,5,6-d4)-propanoic Acid

Sign In for Pricing
View Details
S100 calcium binding protein A14 (S100A14) Human Gene Knockout Kit (CRISPR)
KN402590 1 Kit

S100 calcium binding protein A14 (S100A14) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CYB5R3 Antibody
RC-5018-01 50 μL

Recombinant CYB5R3 Antibody

Sign In for Pricing
View Details
Recombinant CYB5R3 Antibody
RC-5018-02 100 µL

Recombinant CYB5R3 Antibody

Sign In for Pricing
View Details
Recombinant CYB5R3 Antibody
RC-5018-03 1 mL

Recombinant CYB5R3 Antibody

Sign In for Pricing
View Details