Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q2YTK5

Expression Region

1-121

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLVANLTGAFIMGLLTALTIAFFSNHPT LKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAITSYVFGILLCYVGIKLGGGL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Propenyl-(propyl-d7)-propanedioic Acid Diethyl Ester
TRC-P769002-25MG 25 mg

2-Propenyl-(propyl-d7)-propanedioic Acid Diethyl Ester

Sign In for Pricing
View Details
Human Complement C5 Recombinant Rabbit monoclonal Antibody
HA725127H 100 µL

Human Complement C5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Multi Angle Spectrophotometer BMAS-1204
BMAS-1204 1 Unit

Multi Angle Spectrophotometer BMAS-1204

Sign In for Pricing
View Details
Weighing Scale BBAL-405
BBAL-405 1 Unit

Weighing Scale BBAL-405

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), Biotin conjugate, 0.1mg/mL
BNCB0371-500 1x 500 µL

Cytokeratin, pan (AE-1 / AE-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Urine Total RNA Purification Maxi Kit (Slurry Format)
29600 50 Preparations

Urine Total RNA Purification Maxi Kit (Slurry Format)

Sign In for Pricing
View Details