Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q49YL2

Expression Region

1-121

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLFIFLGGAVGALLRYLLSFINTSFEMPIGTFIANLCGAFLMGFLGTLAIQYFNNSPM LKKGITTGFIGSLTTFSTFQFELVQFFESGSFILLIVYALTSYIFGILLCFLGVRLGAKI S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3PX1 (SNX9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A11]
TA501323AM 100 µL

SH3PX1 (SNX9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A11]

Sign In for Pricing
View Details
Bis(2,3-dichloropropyl) Ether
TRC-B426220-10MG 10 mg

Bis(2,3-dichloropropyl) Ether

Sign In for Pricing
View Details
ROMO1 (NM_080748) Human Recombinant Protein
TP310655L 1 mg

ROMO1 (NM_080748) Human Recombinant Protein

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF640R conjugate, 0.1mg/mL
BNC402741-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gtpbp3 Rabbit Polyclonal Antibody
TA363321 100 µL

Gtpbp3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac erythro-3-(4-Nitrobenzamido)nonan-2-ol
TRC-N492780-250MG 250 mg

rac erythro-3-(4-Nitrobenzamido)nonan-2-ol

Sign In for Pricing
View Details