Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q49YL2

Expression Region

1-121

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLFIFLGGAVGALLRYLLSFINTSFEMPIGTFIANLCGAFLMGFLGTLAIQYFNNSPM LKKGITTGFIGSLTTFSTFQFELVQFFESGSFILLIVYALTSYIFGILLCFLGVRLGAKI S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perfluoro(butylcyclohexane)
TRC-P999370-1G 1 g

Perfluoro(butylcyclohexane)

Sign In for Pricing
View Details
Speg Mouse Gene Knockout Kit (CRISPR)
KN516591 1 Kit

Speg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOH Human
OM296954-01 100 µg

APOH Human

Sign In for Pricing
View Details
APOH Human
OM296954-02 1 mg

APOH Human

Sign In for Pricing
View Details
APOH Human
OM296954-03 5 mg

APOH Human

Sign In for Pricing
View Details
Human SUSD1 activation kit by CRISPRa
GA112071 1 Kit

Human SUSD1 activation kit by CRISPRa

Sign In for Pricing
View Details