Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q4L7C3

Expression Region

1-121

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLFVFIGGLFGALLRYVLSTLNVDSGLPLGTLIANIVGAFLMGYLSSLSIHFFKNNPL IKKGVTTGLLGALTTFSTFQFELVTMSQNNSIALLFIYGLTSYIGGILFCWFGVKLGGQP T

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceramide synthase 2 (CERS2) Human Gene Knockout Kit (CRISPR)
KN200145 1 Kit

Ceramide synthase 2 (CERS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NDUFA5 Rabbit Polyclonal Antibody
TA369228 100 µL

NDUFA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gentiopicroside
TRC-G363100-50MG 50 mg

Gentiopicroside

Sign In for Pricing
View Details
HIST4H4 (acetyl K5) Rabbit Polyclonal Antibody
AP31625PU-N 50 µL

HIST4H4 (acetyl K5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)
PKSH033665-01 10 µg

Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)

Sign In for Pricing
View Details
Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)
PKSH033665-02 50 µg

Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)

Sign In for Pricing
View Details