Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q4L7C3

Expression Region

1-121

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLFVFIGGLFGALLRYVLSTLNVDSGLPLGTLIANIVGAFLMGYLSSLSIHFFKNNPL IKKGVTTGLLGALTTFSTFQFELVTMSQNNSIALLFIYGLTSYIGGILFCWFGVKLGGQP T

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biglycan (BGN) Magnetic Luminex Assay Kit
LKU601858 96 Tests

Biglycan (BGN) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
MAZ sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1273906 1.0 µg DNA

MAZ sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)
MBS1025588-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)
MBS1025588-02 0.1 mg (E-Coli)

Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)
MBS1025588-03 0.02 mg (Yeast)

Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)
MBS1025588-04 0.1 mg (Yeast)

Recombinant Salmonella heidelberg N utilization substance protein B homolog (nusB)

Sign In for Pricing
View Details