Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus haemolyticus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q4L7C3

Expression Region

1-121

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLFVFIGGLFGALLRYVLSTLNVDSGLPLGTLIANIVGAFLMGYLSSLSIHFFKNNPL IKKGVTTGLLGALTTFSTFQFELVTMSQNNSIALLFIYGLTSYIGGILFCWFGVKLGGQP T

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cotinine,Cotinine ELISA KIT
JOT-EKA0155Hu 96 wells

Human Cotinine,Cotinine ELISA KIT

Sign In for Pricing
View Details
USP44 shRNA Plasmid (m)
sc-76858-SH 20 µg

USP44 shRNA Plasmid (m)

Sign In for Pricing
View Details
A2M (A2 Macroglobulin, Alpha-2-Macroglobulin, CPAMD5, DKFZp779B086, FWP007, S863-7, A2MD) (HRP)
MBS6404918-01 0.1 mL

A2M (A2 Macroglobulin, Alpha-2-Macroglobulin, CPAMD5, DKFZp779B086, FWP007, S863-7, A2MD) (HRP)

Sign In for Pricing
View Details
A2M (A2 Macroglobulin, Alpha-2-Macroglobulin, CPAMD5, DKFZp779B086, FWP007, S863-7, A2MD) (HRP)
MBS6404918-02 5x 0.1 mL

A2M (A2 Macroglobulin, Alpha-2-Macroglobulin, CPAMD5, DKFZp779B086, FWP007, S863-7, A2MD) (HRP)

Sign In for Pricing
View Details
STEAP4 Metalloreductase (STEAP4) Antibody
abx430640 200 µL

STEAP4 Metalloreductase (STEAP4) Antibody

Sign In for Pricing
View Details
Quick Step Human West Nile Virus (WNV) elisa Kit
QS3466Hu-01 48 Tests

Quick Step Human West Nile Virus (WNV) elisa Kit

Sign In for Pricing
View Details