Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q5HND1

Expression Region

1-121

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLYIFVGGALGALIRFCLSMLNEGSTIPLGTFVANLLGAFLMGSIGALSLSLFKTHPN IKKGLTTGLLGALTTFSTFQFELVTLFNQHHFILFTIYGVTSYILGILSCYLGVKIGGRF S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trenbolone Enanthate-d13
TRC-T719032-25MG 25 mg

Trenbolone Enanthate-d13

Sign In for Pricing
View Details
YY1 Monoclonal Antibody
AN005360L-01 25 µL

YY1 Monoclonal Antibody

Sign In for Pricing
View Details
YY1 Monoclonal Antibody
AN005360L-02 100 µL

YY1 Monoclonal Antibody

Sign In for Pricing
View Details
Human Fbx32 (FBXO32) activation kit by CRISPRa
GA114493 1 Kit

Human Fbx32 (FBXO32) activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Syntenin 2 (ST2) ELISA Kit
RD-ST2-Ra-01 96 Tests

Rat Syntenin 2 (ST2) ELISA Kit

Sign In for Pricing
View Details
Rat Syntenin 2 (ST2) ELISA Kit
RD-ST2-Ra-02 48 Tests

Rat Syntenin 2 (ST2) ELISA Kit

Sign In for Pricing
View Details