Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q5HND1

Expression Region

1-121

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLYIFVGGALGALIRFCLSMLNEGSTIPLGTFVANLLGAFLMGSIGALSLSLFKTHPN IKKGLTTGLLGALTTFSTFQFELVTLFNQHHFILFTIYGVTSYILGILSCYLGVKIGGRF S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhod-4™ maleimide
21127-AAT 100 µg

Rhod-4™ maleimide

Sign In for Pricing
View Details
2-(Octadecyloxy)ethanol
TRC-O268063-1G 1 g

2-(Octadecyloxy)ethanol

Sign In for Pricing
View Details
Chd7 Mouse Gene Knockout Kit (CRISPR)
KN303251LP 1 Kit

Chd7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse S100B Protein (His Tag)
PDEM100211-01 20 µg

Recombinant Mouse S100B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse S100B Protein (His Tag)
PDEM100211-02 100 µg

Recombinant Mouse S100B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse S100B Protein (His Tag)
PDEM100211-03 500 µg

Recombinant Mouse S100B Protein (His Tag)

Sign In for Pricing
View Details