Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

This Recombinant Bacillus cereus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q637F8

Expression Region

1-121

Origin

Bacillus cereus (strain ZK / E33L)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLECL1 (SIGLEC12) (C-term) Rabbit Polyclonal Antibody
AP18196PU-N 400 µL

SIGLECL1 (SIGLEC12) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RRP8 Polyclonal Antibody
E-AB-52961-01 20 µL

RRP8 Polyclonal Antibody

Sign In for Pricing
View Details
RRP8 Polyclonal Antibody
E-AB-52961-02 60 µL

RRP8 Polyclonal Antibody

Sign In for Pricing
View Details
RRP8 Polyclonal Antibody
E-AB-52961-03 120 µL

RRP8 Polyclonal Antibody

Sign In for Pricing
View Details
RRP8 Polyclonal Antibody
E-AB-52961-04 200 µL

RRP8 Polyclonal Antibody

Sign In for Pricing
View Details
Pefloxacin-d3
TRC-P218312-5MG 5 mg

Pefloxacin-d3

Sign In for Pricing
View Details