Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Holin-like protein CidA (cidA)

This Recombinant Bacillus cereus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q733F5

Expression Region

1-121

Origin

Bacillus cereus (strain ATCC 10987)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-100 1x 100 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF405S conjugate, 0.1mg/mL
BNC040501-500 1x 500 µL

Progesterone Receptor (PR501), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details