Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Protein CrcB homolog (crcB)

This Recombinant Methanococcus maripaludis Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

P61395

Expression Region

1-122

Origin

Methanococcus maripaludis (strain S2 / LL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREILLIGLGGFFGAILRYLVSGIIPVKFGIPTGTLIVNLLGSFIIGFLIYSSLFGSLST EYRLFIITGFCGALTTFSTFSYESFTMLEHNYYLKTGLNILLNVFGCLGMVYLGRLASMF FW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF647 conjugate, 0.1mg/mL
BNC472146-100 1x 100 µL

PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF405S conjugate, 0.1mg/mL
BNC042052-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF488A conjugate, 0.1mg/mL
BNC882883-500 1x 500 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF405S conjugate, 0.1mg/mL
BNC040418-100 1x 100 µL

Fascin-1 (FSCN1/418), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details