Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus Protein CrcB homolog (crcB)

This Recombinant Dichelobacter nodosus Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A5EX40

Expression Region

1-122

Origin

Dichelobacter nodosus (strain VCS1703A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYAFFTIFIGGGLGAVSRHYLSVYLMRMTAINAPWAILLINLLGCLGIGFFSAYLSRLTH AQLWQWFLLTGFLGGFTTYSTFTLNLIQLGEIHLASAFLNLFLHLGGGILCCFVGFWLAR AV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF594 conjugate, 0.1mg/mL
BNC941784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF568 conjugate, 0.1mg/mL
BNC680764-100 1x 100 µL

CD79a (IGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF568 conjugate, 0.1mg/mL
BNC680999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details