Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0382 membrane protein SAOUHSC_00567 (SAOUHSC_00567)

This Recombinant Staphylococcus aureus UPF0382 membrane protein SAOUHSC_00567 (SAOUHSC_00567) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

UPF0382 membrane protein SAOUHSC_00567

UniProt

Q2G0J5

Expression Region

1-122

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF740 conjugate, 0.1mg/mL
BNC742957-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF568 conjugate, 0.1mg/mL
BNC682221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details