Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533 (SAB0533)

This Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533 (SAB0533) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

UPF0382 membrane protein SAB0533

UniProt

Q2YS64

Expression Region

1-122

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGTITPIGGVLFIIGWIMLIIATFKF AG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR561697 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Nor Acetildenafil
TRC-N660500-1MG 1 mg

Nor Acetildenafil

Sign In for Pricing
View Details
TentaGel® HL Diol
HL12010.100G 100 g

TentaGel® HL Diol

Sign In for Pricing
View Details
Human C11orf98 activation kit by CRISPRa
GA119528 1 Kit

Human C11orf98 activation kit by CRISPRa

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Goat Polyclonal Antibody
AB0046-200 400 µg

alpha Tubulin (TUBA4A) Goat Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A12 (NM_001122848) Human Over-expression Lysate
LY426579 100 µg

SLC6A12 (NM_001122848) Human Over-expression Lysate

Sign In for Pricing
View Details