Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533 (SAB0533)

This Recombinant Staphylococcus aureus UPF0382 membrane protein SAB0533 (SAB0533) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

UPF0382 membrane protein SAB0533

UniProt

Q2YS64

Expression Region

1-122

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGTITPIGGVLFIIGWIMLIIATFKF AG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (TP53/1799R), CF405S conjugate, 0.1mg/mL
BNC041799-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slide Drying Cabinet BCBT-303
BCBT-303 1 Unit

Slide Drying Cabinet BCBT-303

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), 0.2mg/mL
BNUB3086-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), 0.2mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF594 conjugate, 0.1mg/mL
BNC942729-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(2,5-Difluorophenyl)acetic Acid
TRC-D445410-1G 1 g

(2,5-Difluorophenyl)acetic Acid

Sign In for Pricing
View Details
1-Ethyl-6-oxo-3-piperidinecarboxylic Acid
TRC-B440660-500MG 500 mg

1-Ethyl-6-oxo-3-piperidinecarboxylic Acid

Sign In for Pricing
View Details