Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q318A9

Expression Region

1-122

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDITAISLVLFGSTFGLIFRMFIQNNLKINIGFNIQNTSIVNFIASFFLGILLALNLTNN NLLLLFYIGFLGCFSTFSSFIYQLFVLLQKRKFMHLFFHYFEVIIISFICFYLGYYLMQI IK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BD 1063-d8 Dihydrochloride
TRC-B129472-1MG 1 mg

BD 1063-d8 Dihydrochloride

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]
E-AB-F1120UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]
E-AB-F1120UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]

Sign In for Pricing
View Details
Human CMPK2 activation kit by CRISPRa
GA115087 1 Kit

Human CMPK2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), 1mg/mL
BNUM0373-50 1x 50 µL

Human IgM Immunoglobulin (IM373), 1mg/mL

Sign In for Pricing
View Details
Human ARMH4 activation kit by CRISPRa
GA115519 1 Kit

Human ARMH4 activation kit by CRISPRa

Sign In for Pricing
View Details