Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q318A9

Expression Region

1-122

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDITAISLVLFGSTFGLIFRMFIQNNLKINIGFNIQNTSIVNFIASFFLGILLALNLTNN NLLLLFYIGFLGCFSTFSSFIYQLFVLLQKRKFMHLFFHYFEVIIISFICFYLGYYLMQI IK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGCR8 Human Gene Knockout Kit (CRISPR)
KN419451 1 Kit

DGCR8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNX8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA502114BM 100 µL

SNX8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit
RD-UBE2C-Hu-01 96 Tests

Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit
RD-UBE2C-Hu-02 48 Tests

Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit

Sign In for Pricing
View Details
FAM167A Human Gene Knockout Kit (CRISPR)
KN417915 1 Kit

FAM167A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Solerole
TRC-S676630-50MG 50 mg

Solerole

Sign In for Pricing
View Details