Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0321 (MJ0321)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0321 (MJ0321) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0321

UniProt

Q57769

Expression Region

1-122

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNNDKIVAIVTSIAVICISLTVIFCDTLVLAVGVPTLVLLWLVFLGWINNKKLDKGEMR RAITGSIVIAFFIILIAISKNPDIYSNNKEIFSLFFGMVTTIIGYYFGYRSGKESKNSSG NE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1S1 Human Gene Knockout Kit (CRISPR)
KN416233 1 Kit

OR1S1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9H5]
TA801325BM 100 µL

ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9H5]

Sign In for Pricing
View Details
BRCC2 (BLID) (NM_001001786) Human Over-expression Lysate
LC424226 20 µg

BRCC2 (BLID) (NM_001001786) Human Over-expression Lysate

Sign In for Pricing
View Details
PIAS4 Antibody
8C0364-AAT 50 µg

PIAS4 Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD4 Antibody[OKT-4]
E-AB-F1231A-01 25 µg

Purified Anti-Human CD4 Antibody[OKT-4]

Sign In for Pricing
View Details
Purified Anti-Human CD4 Antibody[OKT-4]
E-AB-F1231A-02 100 µg

Purified Anti-Human CD4 Antibody[OKT-4]

Sign In for Pricing
View Details