Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis UPF0382 membrane protein SERP0230 (SERP0230)

This Recombinant Staphylococcus epidermidis UPF0382 membrane protein SERP0230 (SERP0230) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

UPF0382 membrane protein SERP0230

UniProt

Q5HRG3

Expression Region

1-122

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVFIILGALNAMMAVGTGAFGAHGLEGKLSDKYMSIWEKATTYQMYHGLGLLVIGLISG TTSINVNWAGWLLFFGIVFFSGSLYFLALTQVRILGAITPIGGVLFIIGWLVLVIATLKF AG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF740 conjugate, 0.1mg/mL
BNC740778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details