Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnetococcus sp. Protein CrcB homolog (crcB)

This Recombinant Magnetococcus sp. Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A0L889

Expression Region

1-123

Origin

Magnetococcus sp. (strain MC-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIAWVALGGAIGAVARYVLSNAVYAWLGRAFPWGTLSVNLLGSFIMGLLFYLFTQRLMV PEALKPLVLVGGLGAFTTFSTFSLETLNLMQSGSWSLALLNMLSSVLLCVLAAYLGLVVG RLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colibactin
TRC-C193280-10MG 10 mg

Colibactin

Sign In for Pricing
View Details
Germacrone (>90%)
TRC-G367755-10MG 10 mg

Germacrone (>90%)

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-19762-01 50 μL

ATP2B4 Antibody

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-19762-02 100 µL

ATP2B4 Antibody

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-19762-03 1 mL

ATP2B4 Antibody

Sign In for Pricing
View Details
CLCNKB (N-term) Rabbit Polyclonal Antibody
AP50941PU-N 400 µL

CLCNKB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details