Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnetococcus sp. Protein CrcB homolog (crcB)

This Recombinant Magnetococcus sp. Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A0L889

Expression Region

1-123

Origin

Magnetococcus sp. (strain MC-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIAWVALGGAIGAVARYVLSNAVYAWLGRAFPWGTLSVNLLGSFIMGLLFYLFTQRLMV PEALKPLVLVGGLGAFTTFSTFSLETLNLMQSGSWSLALLNMLSSVLLCVLAAYLGLVVG RLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaV1.3 (CACNA1D) Human Gene Knockout Kit (CRISPR)
KN422854 1 Kit

CaV1.3 (CACNA1D) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NIPSNAP3A Rabbit Polyclonal Antibody
TA370337 100 µL

NIPSNAP3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Fibroadipose tissue
CS807676 5x 5 µm

Tissue FFPE Sections, Fibroadipose tissue

Sign In for Pricing
View Details
Caveolin 2 (CAV2) (NM_198212) Human Over-expression Lysate
LC403682 20 µg

Caveolin 2 (CAV2) (NM_198212) Human Over-expression Lysate

Sign In for Pricing
View Details
Adenosine 5'-monophosphate monohydrate
TRC-A281830-500MG 500 mg

Adenosine 5'-monophosphate monohydrate

Sign In for Pricing
View Details
ACTC1 Rabbit Polyclonal Antibody
AP11506PU-N 400 µL

ACTC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details