Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yrdB (yrdB)

This Recombinant Bacillus subtilis Uncharacterized protein yrdB (yrdB) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Uncharacterized protein yrdB

UniProt

O07080

Expression Region

1-123

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLNQTNLLLRFTLEIAALISLGVYAWISFNGYFKYVLTLVLPIAVMIVWSVFAVPHDP SRSGQTVIAVNGVTRLVIELLIFAMAVAALYFSYLKPVSIVFLCLIILHYIISAERIKWL LNQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLINT1 (NM_014666) Human Over-expression Lysate
LS009685 100 µg

CLINT1 (NM_014666) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR137 3'UTR Lenti-reporter-Luc Vector
22504081 1.0 µg

GPR137 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
NME6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
31949156 3x 1.0 µg DNA

NME6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Human YTHDC1
P2220-01 50 µg

Recombinant Human YTHDC1

Sign In for Pricing
View Details
Recombinant Human YTHDC1
P2220-02 200 µg

Recombinant Human YTHDC1

Sign In for Pricing
View Details
Recombinant Human YTHDC1
P2220-03 1 mg

Recombinant Human YTHDC1

Sign In for Pricing
View Details