Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7UZM6

Expression Region

1-123

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELDGFIYILVGSTFGLIVRMFIKYISGKKKIFYSNNILIVNVLASLFLGIFEGLNITNK NLILFIFVGFLGCFSTFSSFIYQLFNLIREKKYLILLIYYAEVILLSFLFFCLGYFITLT FIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM5 alpha (TRIM5) (NM_033034) Human Tagged ORF Clone Lentiviral Particle
RC212800L2V 200 µL

TRIM5 alpha (TRIM5) (NM_033034) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
anti-Cytochrome P450 2A6
YF-PA11234 50 ug

anti-Cytochrome P450 2A6

Sign In for Pricing
View Details
FAM195A Protein Vector (Mouse) (pPB-C-His)
PV177710 500 ng

FAM195A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TASP1 Human Over-expression Lysate
orb1377063 20 µg

TASP1 Human Over-expression Lysate

Sign In for Pricing
View Details
CETP (NM_000078) Human Tagged Lenti ORF Clone
RC206561L2 10 µg

CETP (NM_000078) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ASPSCR1 sgRNA CRISPR Lentivector set (Human)
K0136501 3x 1.0 µg

ASPSCR1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details